PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa07g054710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 386aa    MW: 43542.2 Da    PI: 7.6422
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa07g054710.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.26.5e-1838127495
                     E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     + +++ +l+++ l+lp +f++++++k ++  ++ l+d + rsW + l+ +k  +++++++GWk+F+++ng ++g f++Fkl ++ +++++++
  Csa07g054710.1  38 AHVTAASLERDALYLPQDFTSSNDLKRKC-CKIFLKDGEERSWAMDLRLNKLTDTCYISRGWKHFCDENGKNAGSFFTFKLLEN-GETPLLS 127
                     567888999999***********999655.6*************************************************9874.4445555 PP

2B359.84.9e-19159251197
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     f++ ++++d+lks+rl+lp +f++e+g++  +++++tl  ++g +W  +l  r +sgr+ l+kG k+F +angLk g++++++l++ +++++v+ 
  Csa07g054710.1 159 FVTLTLTNDSLKSSRLYLPLPFVRENGMN--NPRMVTLLGKDGIRWAANL-LRENSGRMSLGKGMKDFSRANGLKIGESFTLELIW-ENATPVLN 249
                     7788899*******************999..5669***************.799999*****************************.77778887 PP

                     EE CS
              B3  96 vf 97 
                     +f
  Csa07g054710.1 250 LF 251
                     76 PP

3B357.13.4e-18261358198
                     EEEE-..-HHHHTT-E....E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
              B3   1 ffkvltpsdvlksgrl....vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                     f++ ++++d+l+++rl     lp +f++e++++k++  ++tl   +g +W  +l  + ++gr+ l+kGWkeF+kangL++g +++++ ++ ++++
  Csa07g054710.1 261 FVTLTVTHDSLNNNRLnlfqGLPLSFMRENDMNKPG--KITLLGNDGTKWIANL-LQESRGRMSLGKGWKEFAKANGLEVGVSFTLESIW-EDTT 351
                     7788999******999888899********999766..7***************.7999999*************************999.8888 PP

                     .EEEEE- CS
              B3  92 lvvkvfr 98 
                     +++++f+
  Csa07g054710.1 352 PMLGLFS 358
                     9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.9E-1730126IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-1832135IPR015300DNA-binding pseudobarrel domain
CDDcd100172.72E-1435128No hitNo description
SMARTSM010196.9E-1935132IPR003340B3 DNA binding domain
PROSITE profilePS5086313.33835132IPR003340B3 DNA binding domain
PfamPF023623.9E-1638125IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.0E-18150248IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-19156252IPR015300DNA-binding pseudobarrel domain
CDDcd100173.08E-18158252No hitNo description
PROSITE profilePS5086313.874159254IPR003340B3 DNA binding domain
SMARTSM010192.0E-27159254IPR003340B3 DNA binding domain
PfamPF023621.2E-18159251IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.1E-16255353IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-17258354IPR015300DNA-binding pseudobarrel domain
CDDcd100172.72E-15260358No hitNo description
PROSITE profilePS5086312.097261360IPR003340B3 DNA binding domain
SMARTSM010198.1E-22261360IPR003340B3 DNA binding domain
PfamPF023628.7E-18261358IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MMIEEASDHQ DNNIEFQRKK KVKQNNPETE ADCSCFVAHV TAASLERDAL YLPQDFTSSN  60
DLKRKCCKIF LKDGEERSWA MDLRLNKLTD TCYISRGWKH FCDENGKNAG SFFTFKLLEN  120
GETPLLSVWP TKSENDRTQG DSNSSQSCED STPPNHNRFV TLTLTNDSLK SSRLYLPLPF  180
VRENGMNNPR MVTLLGKDGI RWAANLLREN SGRMSLGKGM KDFSRANGLK IGESFTLELI  240
WENATPVLNL FCKEVKIQNR FVTLTVTHDS LNNNRLNLFQ GLPLSFMREN DMNKPGKITL  300
LGNDGTKWIA NLLQESRGRM SLGKGWKEFA KANGLEVGVS FTLESIWEDT TPMLGLFSIE  360
STSDKRQQRE CCSTASENSS ISTKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010417230.10.0PREDICTED: B3 domain-containing protein REM12-like
SwissprotP0CAP41e-108REM12_ARATH; B3 domain-containing protein REM12
TrEMBLM4C8L71e-168M4C8L7_BRARP; Uncharacterized protein
STRINGBra000545.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78281641
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24680.11e-109B3 family protein